SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056677|ref|YP_004105144.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056677|ref|YP_004105144.1|
Domain Number 1 Region: 47-457
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.81e-59
Family beta-glycanases 0.00000359
Further Details:      
 
Domain Number 2 Region: 503-560
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000419
Family Type I dockerin domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317056677|ref|YP_004105144.1|
Sequence length 580
Comment glycoside hydrolase family protein [Ruminococcus albus 7]
Sequence
MFKKLISGMTAAVSACTIIFAPASGIIADNVPAASAASVTAAPDSYHDDWLHVNENAEVV
DMYGNPVWMTGCNWFGYNVGSQIFDGVWSINMHQALNEIADHGFNLLRVPMSTEILLQWK
NGKPDPIIKLNEWKNPELTIEGIEGGTPMYSFDIWNKAVEWCRENGIKIMMDIHCATTNA
AGHNYALWYDNKYSEKDWLDALAWFADYYKDDDTVIAIDLKNEPHGKKDDGIFAKWDGSS
DANNWRYAAEKGAKACLEKNPNLLIMVEGIEVYPKFEKGFDWSSNSTDYAHYGDPDYQPY
HGAWWGGNFRGARDYPVNLGKYQSQLVYSPHDYGPLVYEQSWFHLQGKGPNYTSYKFDRE
YLLKEYWYDSWAFLVEEKISPLLMGEWGGRIDSVNDPSGANKHWMEVLRDYMIDKRIHHT
FWCFNENSSDTGGLIASDCNWDHWDEEKYEFVKPSLWKDENGKFISLDHKIKLGKSGNGI
SISDYYSGSYSEQPHNTVTPNYGDVNIDGKVDMSDIVLLMQYLSDPKKCVLSEQGKKNAD
CVDAGNGLNKSDALALQMVVTRKLSKTAFPITSSKLKSLQ
Download sequence
Identical sequences E6UAW4
WP_013498670.1.49193 gi|317056677|ref|YP_004105144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]