SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056854|ref|YP_004105321.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056854|ref|YP_004105321.1|
Domain Number 1 Region: 70-193
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000429
Family Ngr ectodomain-like 0.064
Further Details:      
 
Domain Number 2 Region: 261-319
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000657
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317056854|ref|YP_004105321.1|
Sequence length 326
Comment type 1 dockerin [Ruminococcus albus 7]
Sequence
MLNKRLAACLAAAVFIIGGSGVLPITEKTDNITAYADSYGDFNYEAVSGGVAITAYTGNG
GKVAIPSKISGKKVVSIADNAFFQCDAITSVTIPSTVLSIGNSAFMECESMTSVSIPDSV
KTIGVCAFSGCSSLKKLNLPASLKTVGEAAFADCTALTLVTLPDVGVTYKYEAFLGCTSL
KTVNIPANTAEIEDAAFGFTIGDSESAVYTKLSGFKIGCYMNSKAYIYAVLNDLKYEILD
PDTPDIIFGEDDDDTTGDETAPGDVNGDDIVNIVDLAMTAGHVKGVKSLSEKRKARADVS
GDGNVNVTDISMISAYIKGKKILKKH
Download sequence
Identical sequences E6UC65
gi|317056854|ref|YP_004105321.1| WP_013498844.1.49193 WP_013498844.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]