SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056975|ref|YP_004105442.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056975|ref|YP_004105442.1|
Domain Number 1 Region: 329-386
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000647
Family Type I dockerin domain 0.0019
Further Details:      
 
Domain Number 2 Region: 88-180
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000262
Family Cellulose-binding domain family III 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317056975|ref|YP_004105442.1|
Sequence length 403
Comment type 1 dockerin [Ruminococcus albus 7]
Sequence
MALTLVLFLPYTAVSAKAAPYENYFNKQDDKEVKYDSSYWIQPPSWNTPKIDPRDFDGWV
MLFADKIGLEPEYAHGKVQRVYFSLLGVETPVSTMKFHIFYDTRLKVVENYKGELITPGK
AVEGFTTGSAMVEEGQLAFYAYSDTAVPIEKASLFTIDFRVPEDAEPGELYPIGMSYVDD
GVVCDTFMGNNRDYAEKAQMTFVFTKGIYNGYIKIIGDPRTKKADMTLKIPRDGRKTSTD
PKEWFGKIPDGVEISDMEWTELDSLNEFGEVDKFTAGKVYGLKFRLSPANGSLFSKKFEA
TVNGKKVQYLGNDITNGGVFYTEIEALEKIVGDLNNDGMVNVTDLSLLAAHIKGRRKLPD
TTAADLNSDGKTDITDLSKLAAHIKGRRLLIDPEYTDPTDIPD
Download sequence
Identical sequences E6UDC5
gi|317056975|ref|YP_004105442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]