SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057004|ref|YP_004105471.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057004|ref|YP_004105471.1|
Domain Number 1 Region: 477-532
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000559
Family Type I dockerin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317057004|ref|YP_004105471.1|
Sequence length 534
Comment type 1 dockerin [Ruminococcus albus 7]
Sequence
MNIKKTAAALMAAAMMLGTTAVTGGNAITASAAKNRNGICTYTYIDVKTDADAYASKAGW
LDGGDAVSILGEKYDSNGELWYKIQYELLIGYVPAASISENGKGYQPADYSGDFESYMES
QGFPESYRIYLRKLHEQHPSWIFKAQHLDIDWNNAVNAETVVGRNLVHNGAPESWKSKAR
GAYDANTGTWYQLDTGWVAASDEIIKYYLDPRNFLSENYVFMFENLSYDPAVHTRDGVEA
ILSGTFMDGGYTCPDTWEWFTYADTFMEAAEISGVSPYHLASRCRNEQGVYGAPQSLGTI
WGYENYFNFFDVGAYATASLTAGEMAARYATNYDPDYLLPWTNQYRSIVGGSIFLGNGYI
NREQDTLYLQKFDMVDGGNGYYAHQYMTCVFGQANEAVSLLNAYSDDVLASAMEFKIPVY
DNMPETRCLKPGTVLGEDEIPVKNSGKTVKKDNNNNTNNTNTSNNSNSVSKVDEKYDINS
DGNVNITDASVMTAHILSRKAMNSSSLKKADIDKNGRFEVTDAILVIKYLKNIV
Download sequence
Identical sequences E6UDF4
WP_013498972.1.49193 WP_013498972.1.63498 gi|317057004|ref|YP_004105471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]