SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057024|ref|YP_004105491.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057024|ref|YP_004105491.1|
Domain Number 1 Region: 50-200
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000454
Family Fibronectin type III 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317057024|ref|YP_004105491.1|
Sequence length 220
Comment hypothetical protein Rumal_2377 [Ruminococcus albus 7]
Sequence
MKNNTKRIAASLCIMMMMGAAVPVGVIGGVASINASAETRSVYTPPVITYLKGNKAVKLS
WNAIEGAERYAVAGYMNGEWKMLDRTEDTTYILSGLKDNTEYRVAVIPMLNGKYVKDFSN
SIVVTPKPAYPKVTNIVYNKTYHQFKVSWNKVPNAECYGVAIYLAGKWRIIDQNISADIT
TYTSPKLKPGKTYKMMIGAKVNGKWDLSNVNSRSFMVTVR
Download sequence
Identical sequences E6UDH4
WP_013498992.1.49193 WP_013498992.1.63498 gi|317057024|ref|YP_004105491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]