SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057218|ref|YP_004105685.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057218|ref|YP_004105685.1|
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.92e-39
Family N-utilization substance G protein NusG, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 119-173
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000411
Family N-utilization substance G protein NusG, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317057218|ref|YP_004105685.1|
Sequence length 175
Comment NusG antitermination factor [Ruminococcus albus 7]
Sequence
MAEEAKWYVVHTYSGYENKVAQNIEKVVENRKLHDLIPEVRIPMETVTEIKGEKTVEAEK
KLFPSYVLVKMVLTDDSWYIVRNTRGVTGFVGPGSKPVPLSDREVEALGVDVGTQTVRTD
IAVGDDVIMVGGSFDGMSGTVSSLDLENAAADVTVSMFGRETTVTLPLTQLRKED
Download sequence
Identical sequences E6UFR2
WP_013499180.1.49193 WP_013499180.1.63498 gi|317057218|ref|YP_004105685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]