SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057281|ref|YP_004105748.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057281|ref|YP_004105748.1|
Domain Number 1 Region: 95-219
Classification Level Classification E-value
Superfamily PR-1-like 5.41e-18
Family PR-1-like 0.0075
Further Details:      
 
Domain Number 2 Region: 30-86
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000726
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317057281|ref|YP_004105748.1|
Sequence length 227
Comment hypothetical protein Rumal_2639 [Ruminococcus albus 7]
Sequence
MVKKIIALAAAAVMSVGCISASAATYGKVDINLDGKVNVTDLSMLSAYIKGKKAIYTSVV
SSADLNRDGRVNVTDISMLASYVKGGTKARETTMSQLAKELAVLVNNERRSRGLTAYVYS
SELSAAASKRAQEISKVFDHKRPDGRDCFTVLPEYGISITSAGENIAYGQDSPKSAFNGF
MNSAPHRSSILDANKKYLGVGVYRDGNGTLYWVQLFASGSGMSGSQV
Download sequence
Identical sequences E6UGJ1
WP_013499241.1.49193 WP_013499241.1.63498 gi|317057281|ref|YP_004105748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]