SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057376|ref|YP_004105843.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057376|ref|YP_004105843.1|
Domain Number 1 Region: 62-431
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.68e-86
Family beta-glycanases 0.00000000468
Further Details:      
 
Domain Number 2 Region: 444-504
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000981
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317057376|ref|YP_004105843.1|
Sequence length 521
Comment arabinogalactan endo-1,4-beta-galactosidase [Ruminococcus albus 7]
Sequence
MSVMNTKIFQRSVKICAALTASVLMMTSSANLMTSSAYSRAGTSSYNRSVTFDTFPAAVN
GGEPIRGVDISSILAIEEAGVVFHDDKGNEEDIFRVLYDHDVNYIRVRVWNEPNDGKGHG
YGGGNNDVKTACEIGRRAAKYGMKLLVDIQYSDFWADPAKQTRPKYWASHDHNTLSGEIY
KWTTWVLTAITEAGGDIGMVQVGNETNCFFCGETDMYKICELFASGNKAVRDFDRNILIA
HHFANPAKADHFYWYAKIMNECKLDYDVFAASFYPYWHGTPENLTNVLSTIGNTYNKYVM
VAETAYPYTSDDSDGFGNTISQWSTGVDLDYDISVEGQAESLTDAFQAIANCGGKGIGVF
YWEPAWLGVSGISQSQQRDNWDRYGSGWASSYASEYDQDVTSAGGSSFDNQALFDFRGYP
LESLDVFTRIYPKKNKPEIKWKTRLYGDLDGDGSLSRSDLTLLKNAVIKKCKLDDEQFAV
GDVNADKKVDINDIILLDRYLSNKHGSGMDLIGKSRSFELK
Download sequence
Identical sequences E6UHD1
gi|317057376|ref|YP_004105843.1| WP_013499325.1.49193 WP_013499325.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]