SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057377|ref|YP_004105844.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057377|ref|YP_004105844.1|
Domain Number 1 Region: 539-595
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000562
Family Type I dockerin domain 0.0015
Further Details:      
 
Domain Number 2 Region: 37-88,132-195,226-276
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0000000016
Family TAP-like 0.06
Further Details:      
 
Domain Number 3 Region: 451-504
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00000283
Family Hypothetical protein alr1529 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317057377|ref|YP_004105844.1|
Sequence length 601
Comment hypothetical protein Rumal_2741 [Ruminococcus albus 7]
Sequence
MRGNKILSVLTAAAMLSTTAGISAFAENEEKAAEKKTYNYVALGDSIAAGYGLNKDKGIM
GDPALVITDKLLADPVKGAYPAIFTGYLKELGEKNGVEVKGTNLASTAFRAADIEKVIRQ
AGYKGEFASQILESFVGKGTSEVLAPYHDIYTSYLTEADLVSIQLGGNDIIMSIIPEMLQ
SENPVIKASAMSLMMTLFGAEPEVAVGAGLQVINEEKDKVTADAFLEAANYMKNVGENAE
NMVNNSAEQVKGVVKAVQEVNGEADIALVSLFNPYRTAEGSEDIQEDIFSVIGPLFAEAS
DAAAETEDQTDAKGEPTKEFTENINDKVNKIIELKAALDKVFDYEKMTKVIDAFTLAEDI
DQLKKNLAALATDENMADIKALNDLLGEYVDIEELRNIIGVISSGADVSELPDVAEIIGQ
FSNSEAAAEAKAFAQQIAEPVAMQMAGKNVDPQIKLLNEKLKAIAAETGAVYVDVYNISP
ETDFDPHPNANGHKEIADILFADISKTAEARMNGGKQPVADDTTISDGAEVSAGEDKGVI
GDINGDGVVNVSDIAFAASYVKGNNILEKGTACADADHNGNINITDVVLIAAQVKNIRAL
A
Download sequence
Identical sequences E6UHD2
gi|317057377|ref|YP_004105844.1| WP_013499326.1.49193 WP_013499326.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]