SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057411|ref|YP_004105878.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057411|ref|YP_004105878.1|
Domain Number 1 Region: 76-214
Classification Level Classification E-value
Superfamily L domain-like 1.02e-16
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 2 Region: 267-318
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000873
Family Type I dockerin domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317057411|ref|YP_004105878.1|
Sequence length 327
Comment hypothetical protein Rumal_2775 [Ruminococcus albus 7]
Sequence
MRKLIYGITAAIMLFGTAYTPADVNFFDAVISADAAEAAEYTEDGFGCVNTGDGVRIVSY
TGTDTDLVLPSVIRGRDVTSIAPYCFEFNNTLRHVTISDSIKDIGDHAFFGCRGLISADI
PTGVTSIGNSCFWGCTKLEKVHIPDSVTVLGPLVFSGCTALTDVALPSGLEVLPDYTFNS
CRSLSDVTIPESVTEIRYKCFTDCTSLKTLRIPKDAKIADHAVGFYTEGSSCKLTEGFTM
YVYHGSPAEEYAVRSGVPHLCADAVAGDVNADGTVNVNDIVLIAAHIKGIAPMDTGSAAR
ADVNGDDHVTVTDLSMTAAHVKGKKSL
Download sequence
Identical sequences E6UHV7
WP_013499359.1.49193 WP_013499359.1.63498 gi|317057411|ref|YP_004105878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]