SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057542|ref|YP_004106009.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057542|ref|YP_004106009.1|
Domain Number 1 Region: 793-850
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000314
Family Type I dockerin domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|317057542|ref|YP_004106009.1|
Domain Number - Region: 730-785
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00208
Family Cna protein B-type domain 0.015
Further Details:      
 
Domain Number - Region: 78-198
Classification Level Classification E-value
Superfamily PR-1-like 0.0034
Family PR-1-like 0.0079
Further Details:      
 
Domain Number - Region: 385-408
Classification Level Classification E-value
Superfamily LigA subunit of an aromatic-ring-opening dioxygenase LigAB 0.0902
Family LigA subunit of an aromatic-ring-opening dioxygenase LigAB 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317057542|ref|YP_004106009.1|
Sequence length 869
Comment hypothetical protein Rumal_2909 [Ruminococcus albus 7]
Sequence
MTKRLMKDLLAAAVASAALCGTMIGAHAYDLERHTQAEIKDMYNKMYFDLHDVSQYSEGY
SAEYPTYAGKLEQDTLDDGLDSVNFCRYLAGLPYDVELDSTYNELAQNASLIIYINKVLS
HTPSKPAVMSDAVYELAYKGSGESNIGKGYMNIQASVTEGYMADTDESNISKLGHRRWLL
NPDMQKTGLGAVYDSTAMYVRDKSRKEKFTGDYICWPPANMPYELLGENKNGYAYSVTLN
TKTYSKPERDKVKVTLTSKLLGKTFTFDKNSPSDVSKLVGYFNVSDANITSNNNCIIFNP
GILPRNDVIDVRVTGIYDKDGNEKPVSYKVNYFDLLDADDYTLGFPEDKYEVELGTSMLL
KGYDHPLSSGGYRIWNYCETGGRIRDYFDMIQSGGNIYFTAKKEGVVYLYEGTADDSFDD
IYTKVTVTHKHTRGSWIVEKAPTEMEAGSRFRVCSECGRQVDREVMPATSVAAADIELAE
DRYVYSGEAIEPKIKVHSGGKRLTEGTDYTVSYKDNVYVGTAKLTIKGKGYFSGTKTVDF
AIERREPVQLSKLNITVKSDGLIYTGRAIVPKVTIKEGAYTLVNDKDYTLQLEDNINAGT
GKLTIKGEGDYLGTRSYSFKIEPADIGYPWSVDRIEDVRYTGRPIMIRLELRSPVSGEAL
VEGEDYTVAYANNVGIGKATITVTGMKNHSGTAAMDFNIVSPEDYKGPEQRDDVIDVDCN
TGILIKGGSNDTEVIFVDKDGGVTRMYANADGTLYTNLPEGEYTVWITRSSYMSVRTEIS
AGDDYVSVKADIFRYGDINKDGLVNVTDTSMSAAFTKGKRVPKNDEQRMLSDVNRDGKLN
VTDTSKIAAHSKGKKQLSVTDIPPIPGIS
Download sequence
Identical sequences E6UJ27
WP_013499484.1.49193 WP_013499484.1.63498 gi|317057542|ref|YP_004106009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]