SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057592|ref|YP_004106059.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057592|ref|YP_004106059.1|
Domain Number 1 Region: 142-271
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 9.94e-33
Family VanY-like 0.02
Further Details:      
 
Domain Number 2 Region: 31-89
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000942
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317057592|ref|YP_004106059.1|
Sequence length 287
Comment peptidase M15B and M15C DD-carboxypeptidase VanY/endolysin [Ruminococcus albus 7]
Sequence
MKKDIRKITSAAIAVAAAVVTGTVCAFAAGNGDVNGDGKVTSTDVVSIGAHVKGKRVLSE
NAAAAADVNGDGSITATDITKLAAHIKGKRSLSGYVPPEPQPEPEPEPKGPVITVKNGVT
YVDGILIVNKSYALPRNYGNGLTSATQKAFNAMQAGAKNDGITLWICSGFRSYNTQYDLY
WSYVNRDGQKAADTYSARPGHSEHQSGLAIDINNASTSFNGTREAKWIAAHCAEYGFILR
YPKGKEKKTGFMYESWHVRYVGKDLAKKITKSGLCLEEYLGIDSYYH
Download sequence
Identical sequences E6UJ77
WP_013499534.1.49193 WP_013499534.1.63498 gi|317057592|ref|YP_004106059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]