SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057613|ref|YP_004106080.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057613|ref|YP_004106080.1|
Domain Number 1 Region: 579-638
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000301
Family Type I dockerin domain 0.0014
Further Details:      
 
Domain Number 2 Region: 470-628
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000654
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317057613|ref|YP_004106080.1|
Sequence length 642
Comment hypothetical protein Rumal_2980 [Ruminococcus albus 7]
Sequence
MQSNKKPITNRVISIAMSAAMTMTLLPSTAFTASAASAGSPKTVLSVSNTVIVQPIDVII
EDHSETGLATAAVSFDYIKAELIESDGEVLSELPVNTEDPNIVNANIPLSLAGRDLKLRV
YYSETGYVDTEIFHVMAYRLINYSEWVVLSGQNKTATATYTAGFTPLHADVYVDGEFDRS
CNVSGNTASVTMTENDADLNVLVRMYYGSGENDYVSASTYVSMAYDYEFVDSVFNTVIPE
NEHEAKVCGMLSFSCNKIKVFCGDKVVYASPANDYLTWAPVATISDEYIGQDLFMRAYYT
NDYGYEGYVDSSPFRLVRANTNYHFTKQPNDIDVTNNQLSDLTWEVDFAPVMTEIIFESC
MYTPLDEPTQNFIGAEEFMSDYGSGYYRVRTYYGSGDQDYIESSVFNCVAPEFTVQPVGG
YVADGKKLKVEWKTNFKPIYLALYADDEFVKELDPASTSIELDGKDVNVYEISAKYSNNI
GISSYSFSVIPTTKKIYTVTADKNVYLYNMTISSLSRTAEEGDEFYVYYLGERGEFVSWN
SAASGVTFVDPKDIETSFFMPGKNVTIKYITSTSDHNGLRGDVNGDGSITVTDLSKAAAL
VKGKKTLSAEEAARADVNGDGSVTVSDISRIAAHIKGKKSIS
Download sequence
Identical sequences E6UJ98
WP_013499555.1.49193 WP_013499555.1.63498 gi|317057613|ref|YP_004106080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]