SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057637|ref|YP_004106104.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057637|ref|YP_004106104.1|
Domain Number 1 Region: 61-281
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000106
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 2 Region: 558-613
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000889
Family Type I dockerin domain 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|317057637|ref|YP_004106104.1|
Domain Number - Region: 195-318,431-532
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0471
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317057637|ref|YP_004106104.1|
Sequence length 625
Comment type 1 dockerin [Ruminococcus albus 7]
Sequence
MKKTTVKILSAFCASILAVNAAALNVFAADKTLSPDLTKADDNVLYWADQIGEDKMMWSD
SPTGFTVADNGYLYICSADNIKKIDKFTGKEVLNGKMAGKAMYATKGPVYADGKVFMALD
GGKIQAFDAETLTSLWVYTNKNGGKPTCDIVVENGYLYTGFWNSDEADADFVKVSAADGD
TEKTDEEKTAEWEYTNAGGFYWTSAVVYDGKVTFGVENGKEGANEEGENNRTVTVDDATG
ELISKLGTAHDDIRSKLVLKDGVIYYTSREGGVHLIDTNGEVYGYGITASLLGPNGFTCT
STPIVENGRVYVTFQGTGWDDYNGSHIGVFDIVEAEGKIKLEPAYAVETSAECKAKGVFA
GVDKEGYNVIYYVENGTSGVVRMLRDKAGMTAPADTVEETDLAGKKHTCPPVVFRPQGEH
AQYCAVDPVYDEETGLLYIRNDSFNILAIGSGISDPDIQCPDITIHPNGVKTFVFKADET
PADKEYTVDIKNGPVKTIGDITGKDLTFSVDKFSADDEVLTASFSYGLYNGNGKAPSVSQ
DIDVLVAENDDQYKRALAHKGDVNGDGKVNITDLAIVAANIKSRKVIDKYSFNAADVNAD
GKVNVSDITLTAANIKGKKLINKER
Download sequence
Identical sequences E6UE80
WP_013499579.1.49193 WP_013499579.1.63498 gi|317057637|ref|YP_004106104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]