SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057734|ref|YP_004106201.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057734|ref|YP_004106201.1|
Domain Number 1 Region: 165-280
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-16
Family Transglutaminase core 0.062
Further Details:      
 
Domain Number 2 Region: 322-377
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000118
Family Type I dockerin domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317057734|ref|YP_004106201.1|
Sequence length 381
Comment transglutaminase domain-containing protein [Ruminococcus albus 7]
Sequence
MKYKITALAAAAVIAISSAAGSILTASAAGIRATQDSSDFLTDCSSRAGYDYLGTMKNGK
ALQRAYDKMCDAAEKLWNDTDRTISNLQNYYYYAAIPYDGLTYDEMGIVYVTFKNDFPLY
YFAEGLMVGDAKNFYMVTDISYIKGSARAKAQQDIREYITSTAKKAESAESVYEKALIIH
NAINNDLEYAYDSEGAASGEPWAHNILGACCNGKGVCECYARTFQAVMNYLDIDNYFVSG
MTDQGDHAWNAVRMDDGKCYYVDCTWDDVSGRNIYFAKGKRTMSADHKVDVPCDDPLRFF
IKLPDISYTDLDPQTILRERETGDINGDETVNVTDISIIAAHIKSVRPLYGINLKYADIT
GDGKVNISDLSKLAAKVKGKS
Download sequence
Identical sequences E6UF40
WP_013499674.1.49193 WP_013499674.1.63498 gi|317057734|ref|YP_004106201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]