SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317057836|ref|YP_004106303.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317057836|ref|YP_004106303.1|
Domain Number 1 Region: 27-86
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000262
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317057836|ref|YP_004106303.1|
Sequence length 307
Comment hypothetical protein Rumal_3206 [Ruminococcus albus 7]
Sequence
MNKLIMTAVSLICACSISAYADGASAAKGDVNGDGAVTITDVSKIAAHIKTKKMIQGESL
QNADVNYDGKVNISDLSLTAAYIKGKKTFPDDPRIADETFKGYDAFLMFADGSMNWGNWN
GQGYYSAPSFGDDADITNDGVYSVSITKKSITAKDDTGTNPSLLYGSDGSLLPAKGCTML
CVDITGLLDGTLAADGSELEGFLKSGNDANVNKHVKGKFRGDELNVTVTGIAIDGNYIEF
DPSKIRYGNLDEEDNCYRICIADLLSGSAEDAAIDTGNLSFKNSITVEFSISGIDKNEHT
SYDDIFG
Download sequence
Identical sequences E6UFZ5
WP_013499775.1.49193 WP_013499775.1.63498 gi|317057836|ref|YP_004106303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]