SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317133774|ref|YP_004089685.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317133774|ref|YP_004089685.1|
Domain Number 1 Region: 515-574
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000209
Family Type I dockerin domain 0.0022
Further Details:      
 
Domain Number 2 Region: 71-108,247-294,362-424
Classification Level Classification E-value
Superfamily L domain-like 0.000000782
Family Ngr ectodomain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317133774|ref|YP_004089685.1|
Sequence length 580
Comment hypothetical protein Rumal_3337 [Ruminococcus albus 7]
Sequence
MKFKNIFSGLVSALMLSANSMSITTYADVSEAKQWGDNASYVIDYDTATVTITGKGKLKN
TDTAGNYDSPFKGDTFIEKVVISEGITSLCNNAFNGCANLKEVDLPDSLEFIGRNAFTGT
ELFNSQIKEKSNELIMVDNWVVDFSKKGEDITELVIPDGCVGIGTEAFKKLIVGIDLFYR
TKSIENIVFPNTLKYINYGAFNESEMKLTSLELPTENDLYIDDYAFSNAFSDNVNDTVKA
LDIDIPGNVKGIGAFAFSGNKRLQGVTLNDGLRTLSHNAFDGCSISEQVVIPDSLERLGN
GAFKNTPFEKQFDSSAEKALYLGNWLYKINGNNPSYIDIREGTLGIADSPGIPVTAEFKL
PSTLKYIGSNAFAGQKKEKILLPESIEAIYPSAFENSGIKAINFPNGLKYIGSKAFKGCK
GITKAVIPESVEFIGDGAFSGLNNSNNGTTVIVYSKNCIIEQIEYVNVYAINYALDFNYI
VGYKGSTAEEYSNKYATVQHPYMQEDVYYRTFKPLLFGDVNTDSVINVSDITKIAAHIKG
KKLLDENAQKFADVNGDGVINVSDITKIAAHIKGKKLLTQ
Download sequence
Identical sequences E6UJF3
WP_013483349.1.49193 WP_013483349.1.63498 gi|317133774|ref|YP_004089685.1|NC_014824 gi|317133774|ref|YP_004089685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]