SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317133924|ref|YP_004089835.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317133924|ref|YP_004089835.1|
Domain Number 1 Region: 476-536
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000598
Family Type I dockerin domain 0.0022
Further Details:      
 
Domain Number 2 Region: 353-466
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000453
Family NPCBM-like 0.031
Further Details:      
 
Weak hits

Sequence:  gi|317133924|ref|YP_004089835.1|
Domain Number - Region: 56-167
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0315
Family CBM4/9 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317133924|ref|YP_004089835.1|
Sequence length 540
Comment hypothetical protein Rumal_3504 [Ruminococcus albus 7]
Sequence
MKKIITSMLAVSMITGMACMSAGAEAEYNNANSNVMVANENHISATNPVVDLLKSATNGK
DSPYNHYTVYDGSDAKSFKVKGRTYYYGITQNGNISSFSLNTQKVKKLSFKVAHLDNSSL
VDDSTLTIYLDGEKYKTYTLTYNMTYLPIDIDTTEFSKVRFDFGEYKDSRFALVDFKVDG
KTAPKGADIPKYTSVDSLINSAYDTDTFWLSETTIYDSSKKLGFKMKGRTYYNGISMRSG
GGFSLNTENVDSISFDLSHVDNSGIGDSAVKIYLDNELYENKAISIAPNTPIKRYTLDLK
NIDNLRIETNRYTETSYAVGNIEFNNIKSQKSYIVPTYDDAIDFINSKFNDSGVTVYDNT
QKLGFNMDGVNYKQGLLMSAGGTVSFNTESIKKLSFKLGYIDNSVPYSGNKLQVYLDGEL
KEISIEKNQKNQKTQNVDLDVSNVKCVKINFSDKYANTKYGLADIAIIKDESKVNIPKGD
VNLDNVVNITDITKVAAHIKGKKVLTGDSLKAADVNDDNKINITDITKIAAHIKGRIILK
Download sequence
Identical sequences E6UJV3
gi|317133924|ref|YP_004089835.1| WP_013483498.1.49193 WP_013483498.1.63498 gi|317133924|ref|YP_004089835.1|NC_014824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]