SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317133979|ref|YP_004089890.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317133979|ref|YP_004089890.1|
Domain Number 1 Region: 177-359
Classification Level Classification E-value
Superfamily L domain-like 1.93e-25
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 426-561
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000000000451
Family Transglutaminase core 0.019
Further Details:      
 
Domain Number 3 Region: 590-642
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000981
Family Type I dockerin domain 0.0042
Further Details:      
 
Domain Number 4 Region: 82-176
Classification Level Classification E-value
Superfamily L domain-like 0.000000163
Family Ngr ectodomain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317133979|ref|YP_004089890.1|
Sequence length 649
Comment transglutaminase domain-containing protein [Ruminococcus albus 7]
Sequence
MNINIKSKRIIAGVMALSIVSSGAIASESSVIGRLILLNSLSASAGTVYGDWEYEVTGDH
TAKLVKYTGSDAEISIPQGIDGHSITELGENLFSNNTNIKSVKIPRGIQSIPGYCFSNAS
NLESVVMPLGVTKIERGAFMNAKSLTSIALPLSVDTIESSAFTGSGITSINMRDVNEFGK
RIFTDCKNLKDVVLPDGITIIPESTFENCIGIESIILPDDLITIEKNAFKGCTNLTEINA
PDSLTTIKNSAFMNCSKLKKTPCSESTVSIEFAAFRNCTGLESVSFSNSPTSIGSYAFAG
CEKLEYISIPDSVEKIDSDAFSECKGIRSIDLDVNSATKFGGYCFKGCSSVENINVSDFD
ILAGLFDKRTFSGCKELRTINNESPVILNGDNTEPEFTEKYRSVIIENFDAIDDSELGFF
NDYLEAEVKYVVSTNITDDMSDMEKIKTLHDWLCNKVFYKYIKKNSKYTPDTSNYTQVDS
SAFIRNSTVCAGYAKALTLLLNESGVEAYLLVNFSEHAWCMVRVGDHYFHLDATHDDSGS
DPNGTIGYDHFLISDTDVKKCSSGHSSWAIDAPTSRYKYTIPDEIPKCLYSVGDVNKDGV
INDDDADLIWYYCNGDIGSIDLVLADTNFDGKVDWDDYLAALKRKLPRG
Download sequence
Identical sequences E6UK08
gi|317133979|ref|YP_004089890.1| WP_013483553.1.49193 WP_013483553.1.63498 gi|317133979|ref|YP_004089890.1|NC_014824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]