SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317134002|ref|YP_004089913.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317134002|ref|YP_004089913.1|
Domain Number 1 Region: 581-642
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000118
Family Type I dockerin domain 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|317134002|ref|YP_004089913.1|
Domain Number - Region: 119-159
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0145
Family Cna protein B-type domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317134002|ref|YP_004089913.1|
Sequence length 646
Comment Dockerin type 1 [Ruminococcus albus 7]
Sequence
MSKKYNRVLAGIISLTLMFSMTITVSAVENEMDSNSYDSSNTSVSYPEASTNKIAVNDIY
LMDSEDMSFGTVYNPAILRSNSPKYCGLKVKLTKQGDITLSMTATSNKVSLLFVDSNGSI
KEKYDYTGRTNEVGQIKLAKVPAGNYYVVIYNKGVTSDTVVSDLFIKSSVIFDITDTGKL
KATTDYSKNEAVPAYKFKYNGVELKENVDYKVLRTSSSNKKISGGIEYSFTVEIQGLGNY
VGKTSRTFINSVDDENNKINFIECEVSEPTYKGENPVFVVKHKGKILTENKDYKIVINTS
DVTKSGVTYRTYNCTFIGMGNYAGSFSYKIENHKISDTTKKNISSCSITPVFSKGEFVKL
IVMDNDKTLAQNTDYTYTVTKTGETEKNGITTISYEIVVYGIGSYIGSCTANGTTQKNGK
IVLNFSDYSVGDKEYTGRQITPNPTLVITDRNGKEITLKKDEDYTITYGSNTAVGFLAGN
FTIKGIGNYTGTSYIRFNIVPAKINDIKGSPISVGYTGKAATPFNDKIRLSDGRAVLYGI
DYTVEYSNNVKIGTATAVIKFKGNYQGTVTKKFSIVEGTTLSKGDVNGDGKINITDITLA
AAHIKGRKIIDSKDDLLRVDVNEDGKVNITDIVVIAAHIKGKKTLK
Download sequence
Identical sequences E6UK31
gi|317134002|ref|YP_004089913.1| WP_013483576.1.49193 WP_013483576.1.63498 gi|317134002|ref|YP_004089913.1|NC_014824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]