SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055512|ref|YP_004103979.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055512|ref|YP_004103979.1|
Domain Number 1 Region: 359-516
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000856
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 2 Region: 540-599
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000562
Family Type I dockerin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 118-288
Classification Level Classification E-value
Superfamily L domain-like 0.000000000312
Family Ngr ectodomain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317055512|ref|YP_004103979.1|
Sequence length 605
Comment fibronectin type III domain-containing protein [Ruminococcus albus 7]
Sequence
MKKRIISGLAALAIVLSGSGAVVGNVVDLQFDIAASAESVASGTCGENLTWSLDNEGTLT
IRGTGKMNNYAHSYDSDIGKGYSSSIKRIVIEEGVTSIGNNAFTTYCNGITDVTIPEGVT
SIGANAFDGCGLTSINLPDSVTSIGDFAFADCTKLKSVTIPRNVSSIGKNVFKSWFDSAL
ESINVDPDNSYYSSVDGVMYNKDMTKLVAFPCGKTSVTLPDTLTSIDENAFYEFEKLESV
IIPNGVKSIGESAFEGCRKLKSITIPESVESIGKNAFYDCTAMTSATLPKSNIKIGEYAI
GYYYYMPDEWNWWSPDPPDGPRVNQNFKIYCYEGTSGEQYAKNNKIAYELREDIGPANPV
VTYTPGDGCVTLKWKAVKDAEKYAVAVEVDGEWTIVENTSDTSFVLRNLKPGVNYSVAVL
SMFDSEWYVNYSNMITVTPYEKTPVYPIVTNTEYNEKYNQFRIHWSEVEDAEKYGVAVYI
KGKWKIADQNIPATKTSYTSPKLTPGHQYKVAVCAKVNGNWQTDKINSRAVTVTIVKGTT
LLKGDVNGDGEITVTDLTKVAAHIKGKKLLSDDEKLRVDVNGDGIINITDISKIVAHIKG
EKLLS
Download sequence
Identical sequences E6UIP3
gi|317055512|ref|YP_004103979.1| WP_013497527.1.49193 WP_013497527.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]