SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056965|ref|YP_004105432.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056965|ref|YP_004105432.1|
Domain Number 1 Region: 285-361,574-666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000659
Family ABC transporter ATPase domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 57-160
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000000275
Family PHP domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317056965|ref|YP_004105432.1|
Sequence length 734
Comment phosphotransferase domain-containing protein [Ruminococcus albus 7]
Sequence
MHECLVYYKLGFVIIFSAYYYAIIYAKQELDKWKDMKLISITIAVCIIVKRGELALKKLD
LHIHTKKSVSDHPFEFSIDKLKEYVTQMGIDGIAITNHNLFDKDQFFAIQNELNGVCVVL
PGIEIDLGIKSDGHIICITTQDDIDDFSQKCDKINALIKEQSDFVKYDDFKLIFTDLGKY
LWIPHYDKDPILDKEIIKDMGENIKCGEVGSVKKFIYNQNNPECLIPVYFSDTRFTADLP
KLPLRQTYFDIDEINVATIKRSLLSRTHVSLTEEEGHSLFYVLPDLKISTGLNVIVGGRS
SGKTYTLNEISKANDNVKYLKQFSLIEQDPETSAKIFADKIANKRNSFAEEYFDLFKEAV
SSVKNISIKDDEAKIEQYITSLVKCAKETDRVDMFSKCALYNEETFPKRKLEGLEKLISA
TETLLGAREYRELIDKHIPYSSLVSLLHDLVYKYRQEKELSLKEKWVGDLVKDVKRALKT
RSATTEISEVDFYECQLNRKRVQKFNKLAKLVKQEEIISNQEIENFNVQAKKRAFKNAQE
LKDFSGRRNIRFSDVIDLYDNNPQEYLLALKEMENIPDSDYYKYFAYIEYAVLNQYGFEV
SGGERAEFNLLQEINDAYRYDLLLIDEPESSFDNIFLKEKVNHIIKELSKTMPVILVTHN
NTVGASIKPDYLIHTKRIIGKDIRHERYCGLPSSKNLISNSGESIKNIDVMMDCLEAGQA
TYDERRNDYELLKN
Download sequence
Identical sequences E6UDB5
WP_013498934.1.49193 WP_013498934.1.63498 gi|317056965|ref|YP_004105432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]