SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|322688683|ref|YP_004208417.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322688683|ref|YP_004208417.1|
Domain Number 1 Region: 189-258
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000314
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|322688683|ref|YP_004208417.1|
Domain Number - Region: 240-260,305-341
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0902
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322688683|ref|YP_004208417.1|
Sequence length 391
Comment hypothetical protein BLIF_0495 [Bifidobacterium longum subsp. infantis 157F]
Sequence
MKHLSHRTIAIIVALLSTLSLALAVISLPHQAYAVDGTDGTSGTNSTSQGSDGDSAPIAG
PVPNIIVTNFTYGGDSVAAGADFNLDFTFQNMGQVAVTNMVITVDGGESFAIAGGTNTFY
VDALWGGYAMTQSVPMQALASAKSGAQPVTVNFRYEYVDASARSSSQSDVKISVPISQPD
RFEISDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEGEGFDATMKTQYVGNVASG
TTGTIGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLTIPVTDMQPMDDSGMADPNMD
QNANQGLPVLVYVVIVVIAVVIIVVIVLLVRRRRKQKAKKNDIDEDWDDWSEGKDDKTDT
GVTDGAAADTAPITPVTPASSVAPAGSSHKA
Download sequence
Identical sequences A0A0M5L9S5 E8MS95
gi|322688683|ref|YP_004208417.1| WP_015713386.1.15467 WP_015713386.1.31269 WP_015713386.1.46548 WP_015713386.1.70526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]