SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383766180|ref|YP_005445161.1| from Phycisphaera mikurensis NBRC 102666

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383766180|ref|YP_005445161.1|
Domain Number 1 Region: 46-237
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.53e-26
Family Endonuclease I 0.004
Further Details:      
 
Weak hits

Sequence:  gi|383766180|ref|YP_005445161.1|
Domain Number - Region: 508-557
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00955
Family Type I dockerin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383766180|ref|YP_005445161.1|
Sequence length 726
Comment putative ribonuclease [Phycisphaera mikurensis NBRC 102666]
Sequence
MRAVVCLVLVAAASPASADAFDAPAGFYDGVGGTGASLERDLRERMSRGHNQSRYGDMKD
SAAILDADPERPGFLLTAYDRQSVRARWDGGRTWNREHVWPQSRQPGSARDSSRGNLGDQ
HALRPADPRLNSSRGNEHFVGAGLTGGPRRTGGGFFPGTADRGDVARSLFYSSTRYGLGL
VRGEPGGQQMGDLDTLVAWHYLDTPDDFERRRNHAVYSRDLNPRFFQNNRNAYVDLPEAV
WSVFVDQRNDSRLSLAGAATDADGGSARTQRETVYRGASPSRAGGTLGLAAEGVDPTYYR
VTAAGVLSLTDPSGDGDATTLRAAVGPAAFDAGPAPVGYRVAGGLSATAGRKAGSLTLDN
LDLTTDGGRGRGANDADDVFTYELTVLDHATASLAAGETRRSGSLDLGVVALGGPGFAED
VAVFNRSGTPGFTADLLADGTRSDDARVSAGSFGTVAGGAAGTARVLLRGDRLGSVDARV
SLDAREPAFAGQRPIEGLDLSVTGRVALGGDATLDGRVDARDAAALRAGRLAGADAWTGG
DFDRDADVDADDLLVFAAGFGTVENAGEAARAGGPAAGSGDAVLAAGANASAGDGSADFL
YDVLTGDFFVDADGESLWSVSVTTLADASAAGSPAADWAFADFGNQLELTDRSAGAAATD
GSFLFASLTAGLTADAFGGVSYFSLASDTARTGGVVLLIPEPGTLAGAAVLLVFASRRPR
TAGASA
Download sequence
Identical sequences I0IDC6
gi|383766180|ref|YP_005445161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]