SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383766579|ref|YP_005445560.1| from Phycisphaera mikurensis NBRC 102666

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383766579|ref|YP_005445560.1|
Domain Number - Region: 5-31
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00785
Family Rubredoxin 0.038
Further Details:      
 
Domain Number - Region: 19-56
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0883
Family Recombination endonuclease VII, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383766579|ref|YP_005445560.1|
Sequence length 103
Comment hypothetical protein PSMK_15040 [Phycisphaera mikurensis NBRC 102666]
Sequence
MRDSRCAACGYDLIGLPGSGRCPECGERYDKETRLNVSDRTKPAAPGGAGRWRFPLIALG
LAGAVVAIGGVYGVQTADPLRPISASLVLAAALLMAALWSLGR
Download sequence
Identical sequences I0IEH5
WP_014436881.1.29391 gi|383766579|ref|YP_005445560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]