SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|387132826|ref|YP_006298798.1| from Prevotella intermedia 17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387132826|ref|YP_006298798.1|
Domain Number 1 Region: 781-1002
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000141
Family FCH domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|387132826|ref|YP_006298798.1|
Domain Number - Region: 1182-1351
Classification Level Classification E-value
Superfamily PhoU-like 0.068
Family PhoU-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387132826|ref|YP_006298798.1|
Sequence length 1545
Comment tape measure domain protein [Prevotella intermedia 17]
Sequence
MANAQPVKIELLMVDKLSPNMDKSQRKVKELQQNVAAANRELENTEQISNRLTRSVGKLA
AAFTIKEFVSEVAKVRGQFQQLEVAFTTMLQSEEKANALMMQLVRTAATTPFGLEDVAQG
AKQLLAYGFEAERVNETLIRLGDIAAGLSVPLNDLVYLYGTTMAQGRLYTQDLNQFTNRG
LPMISELAKQFGVAEDKVRELVEAGKVGFPEVQQVIESLTNEGGKFGGLMAEQSKTIVGQ
IANIEDSISIAFNKLGQQSEGVINTTLSGISYVVEHYERFGRILLAMVATYGTYRAAVML
TAAAKGWATAAEALHYNWLVLVERAQKALNATMLANPYVLVATMLAGVVATMVSAKTETE
RLQDADEAYEAQKQKVIEAEEAHKRRLEELCQIAGDEALSTDTRREALNKLEQKYPNIFA
KYDTEYAKLKNIKKIKEEIALLDGQKSLANPKNEVKTINDRIKTLEKKKSTEYWEESDRN
GSMTKRGGLTKGEEAELKTLYGKRNNLTGQIRKSQVNAYFEKLTGVSNDTLEKEIKRREN
LLAAMKVNGKKYGKIIQGSKSLTGIYSNDELQYQLNKLVAERNRRNAKRDNSAAWGTQAK
KNYEQALKNYNNFVRSKSNKLTKEEYEKQAKELKDDLDQKKKEYDKTKPAKNADAKKTDK
KKLKEEAEAEHRRQMAEKMKQELVDLQRSNDSAEIETMQEGLQKKLREIENEYQARKNAI
DKQESNWKRDNKKAKSAVGKDGLTAEQAEALQKARSQAAVIRKKEIADANREARKEEISA
MVDYLKEYGSFHQQKLALAEEYAQKIAEVDASSVSNAAKAWQKRQLLKEQQKKNSSLSFE
SISRGIDWHVLFSGVGNLAKEMMVPMLEQLRAYVNTDEYKNADADTQQKVTALLQEIRKY
VGTDQSITWRTLDEAVKRFTDSVAVYDRAVKAEEDAVNARNEGKRKLDAGEITNDEYKAL
ENKAQELGDATVKAHESMEDFGAALNRTSDEVANFTSGLTTALNNAKGWQGVEGFNGLQQ
QVGAIDNLKGTLDAILPQMGEGMAKEIGSTLSSTMGTTLSSIGGGISSLLSSGLGSVIGI
VAQIPRLILDLVSGIKGFVTGVLNSITELVSLRWIDDLVVSILDAVGNLINAIFDLPENL
FHVLERIVVNGVGGLLDSVLGRIGNILTLGLLSSSGPSDWFTNSNEKEVAEAIDRLTKRN
ELLEQAIEDLTDEMKTARGSTAIRISNDAERLQRETNDNYKNIARKQAGYHSAHHSWDYY
WKGYSDEQIKRLSEQIGRKWDGNIWSLSPEEMKLLRSNVDMWEQIIKTGKGGYGERVAEK
LNAYIEQAGKLQEITDTLYENLTTTTKKNVFDDFLDSLYALANGSEDVFDDIAENWQAMV
NKMTINNLVGAKFQKNLEVWYEELAKLNKARTNGEITDAEYRKRLDELKKEYDNYVNSAK
SDIEQLRNAGIINSVDKNGGTTQSGKAGAFTTMSQDQATKLEGLFVSGQMHWASIDDRVE
DVAAKMGAAQEHLRKIELNTGSSAQSLKDIKEEMRKITRDGVKVK
Download sequence
Identical sequences A0A1P8JJH9 I1YV09
WP_014709454.1.25991 WP_014709454.1.64095 WP_014709454.1.73680 gi|387132826|ref|YP_006298798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]