SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100243|ref|YP_004175835.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100243|ref|YP_004175835.1|
Domain Number 1 Region: 326-439
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.0000000000576
Family Pseudouridine synthase II TruB 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|320100243|ref|YP_004175835.1|
Domain Number - Region: 164-203
Classification Level Classification E-value
Superfamily THUMP domain-like 0.00296
Family THUMP domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320100243|ref|YP_004175835.1|
Sequence length 444
Comment THUMP domain-containing protein [Desulfurococcus mucosus DSM 2162]
Sequence
MDTGEKDSWSMDHILSTAEEVLSEHPLCDRCLGRLFARRGLDLSNEERGRAVKTLLAMKL
HADFTDGKTSIEHIQRIAVNSGEPVARLYRRLTGESVEPRVCHICLGRLSDEYLDKVARE
AASLLAGLQASSFLIGVKLDAEVARRELEVSLITKLASSESVKNELKREVGKKVSQITGL
QPDFDKPDVVVIINVDRDFNYTLSTQVNPVLLKAVYLKKGRRISHVPWFTSNGARKYPES
LQDFVRDSIASLFEAVDVKIHAAGREDVDARMLGTGRPVIIEILEPRFRSVDIGLLNQIL
DDQFIKVSVTGPASRRDIEAIKEGSRRRKKIYRVSVLTGKPVTMKDLEELSGFFRNRVVK
QRTPLRILGRKKDRERIRRVYSVEAVAVTPRVFEALIHCDGGLYVKELVHCDNGRTTPCF
SEVLGSTAYPLELDVIHVEDNGDK
Download sequence
Identical sequences E8RAE3
gi|320100243|ref|YP_004175835.1| WP_013561575.1.43297 WP_013561575.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]