SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100378|ref|YP_004175970.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100378|ref|YP_004175970.1|
Domain Number 1 Region: 90-250
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.23e-31
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.002
Further Details:      
 
Domain Number 2 Region: 3-94
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.13e-20
Family Ferredoxin reductase FAD-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100378|ref|YP_004175970.1|
Sequence length 281
Comment sulfide dehydrogenase (flavoprotein) subunit SudB [Desulfurococcus mucosus DSM 2162]
Sequence
MPKYVITAKRKLAPRVNWFRIQAPLIARRAQPGQFVIVRLHEKGERIPLTLFDWNANEGF
IELVVQEVGKTTMEMGRYNVGDHVLNITGPLGNPTHIDMYGVVVIVCGGVGSAVCYPVAK
ALRERGNKVISIIGFRTRELVILEEEFRRISDEVIVTTDDGSYGVKGFTTDALRSLLESG
VKPGLVYTAGPVIMMKKVAEITRRHGVLTYASLNPIMVDGTGMCGACRVTVEGRTVFACV
DGPDFDAHKVDFDELAKRLAQYTEEERIALEKYLNTVSRGG
Download sequence
Identical sequences E8R7J3
WP_013561710.1.43297 WP_013561710.1.60640 gi|320100378|ref|YP_004175970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]