SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100544|ref|YP_004176136.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100544|ref|YP_004176136.1|
Domain Number 1 Region: 6-83,174-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.35e-66
Family Bacterial dinuclear zinc exopeptidases 0.00000557
Further Details:      
 
Domain Number 2 Region: 73-182
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.98e-32
Family Aminopeptidase/glucanase lid domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320100544|ref|YP_004176136.1|
Sequence length 366
Comment cellulase [Desulfurococcus mucosus DSM 2162]
Sequence
MSWRNEYLELVRKLTSLHGTSGREDSVRDLVVDLMKPHVDKLWVDVWGNVVGYRKGSKGA
GRIMLAAHMDEIGLFISHIEDDGFLRVIPVGGVLERTLLYQRVVVKTRDGRLYRGVIGLK
PPHVIKPEEAQKVPEIRELFIDVGASSREEVEKMGIRVGDIAVFDRDVAELSGDRITGKA
FDDRVGVAVMLKALESLGEHQVDVYFVATVQEEVGLKGARTSSYGISPDVALAIDVTIAS
DVPGVAKSEWFTRLGYGPAIKVVDGRNASGLIAHPKVVDFLVSVAEKRKIPYQLDVISGG
TTDASIIALNKEGVAAGTISIPSRYIHSPVEVVDLKDLYNASLLAKAFLEEATPEWVQSV
KGLIVK
Download sequence
Identical sequences E8R828
gi|320100544|ref|YP_004176136.1| WP_013561876.1.43297 WP_013561876.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]