SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100551|ref|YP_004176143.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|320100551|ref|YP_004176143.1|
Domain Number - Region: 234-372
Classification Level Classification E-value
Superfamily vWA-like 0.00206
Family Integrin A (or I) domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320100551|ref|YP_004176143.1|
Sequence length 438
Comment hypothetical protein [Desulfurococcus mucosus DSM 2162]
Sequence
MPVSATPRLKLYVLFTSLLLAVAILVDPAALTLALILLALPILSHTLIEVGYSVLEKLRV
SESVRVEKDGRVVVEYMIENPSRIPLLPVEYSVAYSELLRLAEGVKAGLLLVPPRGVVKL
RLVFHGRLGEHTVGPVRAVLRDPFGFYRSSEETLGKAVTLNIPPVPEEVVVRRLFRYARS
TGLVKSKAPGDGVEFYDVRDYFPGDEMKRIVWRVYASRRTLAVWEPEREVYQPVVFILDA
TREMWSGPFGQSMVEHSARITASLIHYLTRRGYPVSTVVFNESVTHASGRPIHGYRGYME
SLRTISRARLSWEGTLQRRSAVSSVLSYTYERILPRDRSIVFLFTHLDEDVLGDVASWNS
IYSARGHVLYIVHPLITSYDTGNIPEWAANVYRVKLMEALRRDIDVLSRARSMGLRVVAV
TPSLIPQRVVDIVERYSA
Download sequence
Identical sequences E8R835
gi|320100551|ref|YP_004176143.1| WP_013561883.1.43297 WP_013561883.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]