SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100579|ref|YP_004176171.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100579|ref|YP_004176171.1|
Domain Number 1 Region: 9-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000734
Family MarR-like transcriptional regulators 0.092
Further Details:      
 
Weak hits

Sequence:  gi|320100579|ref|YP_004176171.1|
Domain Number - Region: 107-146
Classification Level Classification E-value
Superfamily Prefoldin 0.0141
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320100579|ref|YP_004176171.1|
Sequence length 254
Comment hypothetical protein [Desulfurococcus mucosus DSM 2162]
Sequence
MQARSYTLKALELLNSAPSLSVRDVAEALGVDVARAKEILERLRYGGYVEKAGHGYAITE
KGRALLADHAEQGSPTLTSFIQGKQGSTEAGGGKTGTDTPRQTPPQPVGEAPDALAKRVE
ELSNRLRELESRLRDIESRLASLEGFVRDAARRSGAEARGGEGLGMETPVMSIAEAQSRL
GTLLEKYLVEGRLIRVGSLVVDSAFYGEFKKRFPIKAGDVGRLSPAERMLLEEMRREMMV
ILYAGREYRLVDTG
Download sequence
Identical sequences E8R863
gi|320100579|ref|YP_004176171.1| WP_013561911.1.43297 WP_013561911.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]