SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100586|ref|YP_004176178.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100586|ref|YP_004176178.1|
Domain Number 1 Region: 258-390
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000191
Family Integrin A (or I) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100586|ref|YP_004176178.1|
Sequence length 421
Comment von Willebrand factor type A [Desulfurococcus mucosus DSM 2162]
Sequence
MSGEGGTGFLKGIDYGDPVVKYRGWRVRRLAEKLAGRRLNLQGALAVDVFYILYLPAPVP
REGAGEPGREIIEALLDSPNLPVIRGKTLMDSFTSSIAAAVFLSEVKMLEAALGHTQGAG
RGVDYSEARRIVERALTTVSMDVENVKMLKSIAEGLEPGSLSQLSFEEDAVEVLRLARDV
DARRILEVLRGLKPWELGIEKRRRRFKHGEITGYEYGRDIERVAPSNLALPEDVFYIKYL
QRRLLLYEKAVEESMGPVYVLLDKSGSMDGTKITWGKAVAVSLYLKAVRTGREFYIRFFD
SQPYPLLRVRRRPRPGEALRLIDHVVRVKGAGGTDISRAIITACTDIRTGSAGRESDIVL
ITDGVDRIAESMVRLNLKKADARLITVMVMGDNDGLKRVSQKYMSVEKLDRESMLRVIEL
K
Download sequence
Identical sequences E8R870
WP_013561918.1.43297 WP_013561918.1.60640 gi|320100586|ref|YP_004176178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]