SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100709|ref|YP_004176301.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100709|ref|YP_004176301.1|
Domain Number 1 Region: 13-191,320-402
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.15e-61
Family Bacterial dinuclear zinc exopeptidases 0.00091
Further Details:      
 
Domain Number 2 Region: 191-319
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 7.63e-16
Family Bacterial exopeptidase dimerisation domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320100709|ref|YP_004176301.1|
Sequence length 410
Comment acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase [Desulfurococcus mucosus DSM 2162]
Sequence
MDEAGMREVAGRILSGSIEYPTVLGESYEDIVDFYRELLSEHGVHVTVHRVPDELVRKTL
PREFNPEKPRFILLARIGSGDRIIQFNGHYDVVAPGEGWETPPFKPVIRGDLVYGRGATD
MKGGIAAVLTAMISLAEGREPGVVVEAALVPDEEIGGRTGTGYLVSELGSKPDYVVIAEP
SGLDNIYIGHRGNVWGIVKTYGRQAHGSAPWLGDNAFEKMIVFAQVFLKKYRELISLRKS
SYMYEDERAAQPTITPGGALYAPGSINIVPGEAGFSIDRRLIVEEKVEDVAREIKDMVEK
VAAELGVQASFTLVESSPPAFTPPSHEYTVLLSKVVEKTTGVEPRKTICVGGLDLRYYTL
KGIPAVSYGPGEVGLAHKPNEYIRLSDVVKAAAIYAEYVREFEKTGAPRS
Download sequence
Identical sequences E8R8J3
WP_013562041.1.43297 WP_013562041.1.60640 gi|320100709|ref|YP_004176301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]