SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100762|ref|YP_004176354.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100762|ref|YP_004176354.1|
Domain Number 1 Region: 90-245
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.56e-21
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0071
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000211
Family Ferredoxin reductase FAD-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320100762|ref|YP_004176354.1|
Sequence length 255
Comment dihydroorotate dehydrogenase electron transfer subunit [Desulfurococcus mucosus DSM 2162]
Sequence
MYTPAKVVSTERLSSSMYMKKVKLLDGDTVEPKPFQFILIWVPGVDLLPMSVAGFTSGEI
TLVVRERGEGTRKLLHYDGFLGVSGFHGKGFEPWGYRRILFVAGGSGIAPFFHLAEKAWE
KDIVVDVVWGVREAGELFNPARLLGKPRGDVYVATEDCRVGYCGRASHLASRLVAGNPGK
WDAVIASGPIGLLREACGSLGGFLDVYVNLEAYVKCGVGACGSCVLKPHGLLLCRHGPVF
KCSEVEEFLKGGTGA
Download sequence
Identical sequences E8R8P6
gi|320100762|ref|YP_004176354.1| WP_013562094.1.43297 WP_013562094.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]