SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100796|ref|YP_004176388.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100796|ref|YP_004176388.1|
Domain Number 1 Region: 180-442
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.77e-17
Family Biotin synthase 0.058
Further Details:      
 
Weak hits

Sequence:  gi|320100796|ref|YP_004176388.1|
Domain Number - Region: 72-208
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.00613
Family MTH1675-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100796|ref|YP_004176388.1|
Sequence length 493
Comment radical SAM protein [Desulfurococcus mucosus DSM 2162]
Sequence
MMSNHHGKEFLGFVTTGPPIGMPESLWMRLAAPRIRVDEEGKPREAPYGMRKIEAVLRDA
GFNAAIIDPDHLWKHVDSMKVLMLSHHDYFAYGPPSSEWWSLTGLEPVNRRSFIRLMESP
AVRRAKEKGVKIIAGGPAAWQWLYELELMEKWGVDTVVDGEGEKIVVELVEKALRNEKLP
RYVYVGVGDVPGVDEIPVIKGASVNGLVEVMRGCPRGCKFCSVTLRPLRFIPLEKILAEV
DVNIRAGLKGIILHSEDVLLYHADGVKPRADPVVKLHVEVLKRIGERRSLAWSHASLAAV
KYAEENYRLISRLMNELVLNEHRKFLGVEVGIETGSVRLAREIMRAKASPYPVEEWPNIV
EDAFRIMHENKVIPAATVILGFPGETPDDVVETIELIERLKPYRSIIVPMFFVPMGALKR
DKWFLREHLKREHIDALLAMYNHTIYWAEEILRGFYLKEPYYMPVRLMLRYFIRYVKKQV
DKYVGRLEEIIKS
Download sequence
Identical sequences E8R8T0
WP_013562128.1.43297 WP_013562128.1.60640 gi|320100796|ref|YP_004176388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]