SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100932|ref|YP_004176524.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100932|ref|YP_004176524.1|
Domain Number 1 Region: 18-285
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.26e-54
Family Met-10+ protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320100932|ref|YP_004176524.1|
Sequence length 286
Comment methyltransferase [Desulfurococcus mucosus DSM 2162]
Sequence
MARGSLIKELAREILGEEKAGKVWKRVEFIGDLALIRVPLGMEPWELKPLAEELLKRFNF
VKSVWAAIPGVEGPYRLRSHVLLAGEERSETIYREHGCVFKVDINKVYISPSLNYEHLRI
ARLTRPGETVLNMFAGAGLFSIIIARHAAPRKVYSIDINPYAYQYMVENIRLNHVEDIVE
PILGDAGEVVDSRLSNSSDRVLMPYPELALDYLDKALKALRGGRGWIHVYLHVKTLKGEH
YLVKAEEALRKRLESLGLGSYEIAGKRKIRNVGPRMHQVVLDVKIP
Download sequence
Identical sequences E8R966
gi|320100932|ref|YP_004176524.1| WP_013562264.1.43297 WP_013562264.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]