SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100949|ref|YP_004176541.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100949|ref|YP_004176541.1|
Domain Number 1 Region: 7-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000195
Family PF1790-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100949|ref|YP_004176541.1|
Sequence length 163
Comment regulatory protein MarR [Desulfurococcus mucosus DSM 2162]
Sequence
MTTSLKLLSLMDENGVAIDKLSSETGLSTRTVKRYLRELEEKGLVEQRGELYALTAAGLK
LKKSLQALRARREAPPYIVTDPSSGAQIPLSFRNYKQLLAIIDAGLADKSVLEEHMRKYL
ATWVKDSLGDEYLAYLLETGAIKNLDDLKNYLETILKALGDQA
Download sequence
Identical sequences E8R983
WP_013562281.1.43297 WP_013562281.1.60640 gi|320100949|ref|YP_004176541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]