SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101283|ref|YP_004176875.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101283|ref|YP_004176875.1|
Domain Number 1 Region: 18-203,251-362
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.6e-47
Family tRNA pseudouridine synthase TruD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320101283|ref|YP_004176875.1|
Sequence length 368
Comment tRNA pseudouridine synthase D TruD [Desulfurococcus mucosus DSM 2162]
Sequence
MTPCRVLYPHPLDYVTGLKYCLTDLKVGCWYRVSPDTFRVREIVDAEGFTHQAPRGRDGY
IVLRVVKRGVDTFEALRLLSRRLGIPVGNIYFHGLKDRNATTTSYFYVKRLLVDETVFPL
EEKGVSYEIAGYTRSKPHPGLFKGNEFEVVVDGVNRSQQESLIRITGLIEMHGLPSYYGY
QRFGVRRHNTHLLGKFFLKHYEDLFAKHLLETVYPFEDFEAVLKRVRRNYVGLHYENLYA
ETRYSGRGLSMVVEALHGIIVDAYAGYLYNLLLNKVVEEKGYKGLDEEYPMPGCSGAIQL
YSDIFKAEDVDPAEAKRLPCFHRRGLFKPLNTRVSCSGGSCRLVFSLGPGLYATVVLREL
FKENLILY
Download sequence
Identical sequences E8RA87
gi|320101283|ref|YP_004176875.1| WP_013562615.1.43297 WP_013562615.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]