SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101389|ref|YP_004176981.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101389|ref|YP_004176981.1|
Domain Number 1 Region: 308-470
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.41e-55
Family DNA gyrase/MutL, second domain 0.00000244
Further Details:      
 
Domain Number 2 Region: 16-227
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-38
Family DNA gyrase/MutL, N-terminal domain 0.000000348
Further Details:      
 
Domain Number 3 Region: 231-303
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00000000589
Family Topoisomerase VI-B subunit middle domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320101389|ref|YP_004176981.1|
Sequence length 529
Comment DNA topoisomerase VI subunit B [Desulfurococcus mucosus DSM 2162]
Sequence
MGEAAEKYRAISPAEFFYKYREIAGFSSPARAIYQTVRELVENALDATDAHGILPDVKIS
IKRVDEIQEFYRITVEDNGIGIPPDVVPDAFGRVLFSSKYVLRQTRGMYGLGVKMAVLYG
QMTTGRPVEVITSKSGFKRIYYFKLRIDVNKNEPVIIERSSWRKNRDWHGTIVSITIEGD
WGRAKQKIKEYLFKTAIVTPYANIVALTPDDEIVYYPRVVDKLPSPPVEVKPHPHGVDLE
LLKQIISSHNYSSVEELLIKGFQSIGEATARLILQQAGVDPAKPPVDLTENELLSLVNTL
RSMKDIRAPSTKAISPLGSEIIEAGLKHVFQPEFTYAVSRRPQAYQGHPFVVEAGVAYGG
KTPLSENDKPIILRYANKIPLLYDEGSDVTTLVVKEDIGWDNYMITFPAPIAILVHVCST
KIPFKGVGKESIADVPEVRREIKLALMDVLRELRKYLSKKAREEELKKRAEHLAKYIPEV
ARSLALITSGGDKEAEALLLRRLVSIVSKRTGIPVTEIQGVLESVKIGA
Download sequence
Identical sequences E8RAR3
WP_013562721.1.43297 gi|320101389|ref|YP_004176981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]