SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101423|ref|YP_004177015.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101423|ref|YP_004177015.1|
Domain Number 1 Region: 3-75,163-334
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.86e-67
Family Pyruvate kinase 0.0000346
Further Details:      
 
Domain Number 2 Region: 318-457
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.0000000000000714
Family Pyruvate kinase, C-terminal domain 0.0087
Further Details:      
 
Domain Number 3 Region: 70-162
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000000523
Family Pyruvate kinase beta-barrel domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320101423|ref|YP_004177015.1|
Sequence length 469
Comment pyruvate kinase [Desulfurococcus mucosus DSM 2162]
Sequence
MVKVKIIATLGPSSRDHDVVKKMVREGAAGFRINCAHGDEADWLEYVKIVREVSSELDQA
IPLILDTPGPQVRSGDFQEFKVVRGDKVLFSMDPDAKEGKHIVVPAREFYSAASIGDTIL
YGDGEVSFRVSEVGEGFVEALALNEGVVKPRKKVVVEGKEYDVLFPSETDRRVFKFSSEV
KASFVALSYVRRQRDVEVARDILAKHGWVPGLIAKIETRSGFNNMGEIIRLVDGVMVARG
DLGLHFPLEELPLIQERIVREAVRQGRVVIVATEVLESMIENPRPSRSDVVDLYNSVKDL
VDAVLFTNETAVGKYPVEVVKWARKIIDAAESSLSTALVSEYRSSIEARDLLDKYVQGLV
LLAESLGGVIVGYSRSGRMPTLLSKYRPQIRIYVGVGDKLLAEKLSLRYGLNIVDMSRLI
SGEDEYERGVRKLLETLVGKGHVRPGDIVVETYAKPRDNMHEIRISQLQ
Download sequence
Identical sequences E8R768
gi|320101423|ref|YP_004177015.1| WP_013562755.1.43297 WP_013562755.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]