SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101440|ref|YP_004177032.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101440|ref|YP_004177032.1|
Domain Number 1 Region: 23-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000242
Family Transcription factor E/IIe-alpha, N-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|320101440|ref|YP_004177032.1|
Domain Number - Region: 152-185
Classification Level Classification E-value
Superfamily Prefoldin 0.0549
Family Prefoldin 0.011
Further Details:      
 
Domain Number - Region: 126-159
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0774
Family PhnA zinc-binding domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320101440|ref|YP_004177032.1|
Sequence length 187
Comment transcription factor IIE (TFIIE) subunit alpha [Desulfurococcus mucosus DSM 2162]
Sequence
MKLSKTARAEDTLVEEDGEVLEVLEDLVRGVYGEPGLKLLRFMLEHGYVAEELLTRDTGI
KSNEGRRILQKMSEENIVVPGKLRTGDGVLHIWRLNKPGLRSAVLMRLRKAREKLAARLS
FEAGNIVYECPRCGKRYTLDEAYVNDFICPSDGEVLVESNKGEAVRVLQESISRIDALIR
RLERVRE
Download sequence
Identical sequences E8R785
WP_013562772.1.43297 WP_013562772.1.60640 gi|320101440|ref|YP_004177032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]