SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101498|ref|YP_004177090.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101498|ref|YP_004177090.1|
Domain Number 1 Region: 11-176,205-219
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-47
Family Ribonuclease PH domain 1-like 0.00000401
Further Details:      
 
Domain Number 2 Region: 191-275
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.83e-23
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320101498|ref|YP_004177090.1|
Sequence length 286
Comment ribosomal RNA-processing protein RRP42 [Desulfurococcus mucosus DSM 2162]
Sequence
MSITPEKEPLLPRLQVENIIKSIKRGERIDGRGLYDYRPLEVVLNPIQKASGSSLVRLGG
TQVIAGVKLELGEPFPDRPNEGVLQVHAEFVPLASPSFEPGPPDENSIEIARIIDRSLRE
PKAVKLDTLVVEPGKVVWVVFDDIYLVDHQGNITDASMMASMLALATARIPGLVKTETGY
RVDNTKQTGPLPINTLVVTVTMGIYGDTIVVDPSLEEEAVLDSFLTIAVDEAGRICGVQK
RGMKGFSRNTLENAVNTALSKGRDLIELLRKILNNPGEYMKPLVSE
Download sequence
Identical sequences E8R7E3
WP_013562830.1.43297 WP_013562830.1.60640 gi|320101498|ref|YP_004177090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]