SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101535|ref|YP_004177127.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101535|ref|YP_004177127.1|
Domain Number 1 Region: 11-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-37
Family Translational machinery components 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320101535|ref|YP_004177127.1|
Sequence length 140
Comment 30S ribosomal protein S9 [Desulfurococcus mucosus DSM 2162]
Sequence
MSEATSERVKIVVSSGKRKTSIARAVIKPGAGRVWINNTPLEIIPFELARMKILEPLLLI
GDLAKTIDVKVNVNGGGYMSQAEAARIAIARGLVEFFESDHVKTILKEYDRYMLSGDPRQ
TEPKKWGRYSARRRWQKSYR
Download sequence
Identical sequences E8R7I0
WP_013562867.1.43297 gi|320101535|ref|YP_004177127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]