SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333909340|ref|YP_004482926.1| from Marinomonas posidonica IVIA-Po-181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333909340|ref|YP_004482926.1|
Domain Number 1 Region: 175-374
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.83e-32
Family Peptidoglycan hydrolase LytM 0.0042
Further Details:      
 
Domain Number 2 Region: 32-88
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.00000907
Family Troponin I 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333909340|ref|YP_004482926.1|
Sequence length 377
Comment peptidase M23 [Marinomonas posidonica IVIA-Po-181]
Sequence
MIGFIRSFLLCFILLPSVSLAVGEPQTPEEAKQQIQALQKDLKKLNTWLKEIKSERSDVE
KQLEGKEKDIQELLKKIQSIQDSLKKGEQQLSELRVQQRSLQLSIQQQNDQIAAQLRAVY
RSGKEESIKLFLNGNNSEDAQRLVQYNRYFSNARQSLINGFITEVNDLNLVEKSIRSHRA
QQAREDVELRSQRKSLLSQQSQRRTLLAKLDSDLAKGGQKANQLKQDQQNLQALLQQLEE
ALADIQIPDPEVPFSSLRGQLVNPLKRMAKLPSGGIDLGGVTLKAQEGEPVRAISQGRVV
FADWMRGFGFLLILDHGDGYMSMYGYNQSLLKEVGEWVGANDIVAMAGSTGGRPDSALFF
AIRHNGAPLNPLSWVSG
Download sequence
Identical sequences F6D1B8
WP_013797478.1.19944 gi|333909340|ref|YP_004482926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]