SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428220158|ref|YP_007104328.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220158|ref|YP_007104328.1|
Domain Number 1 Region: 5-37
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0000262
Family Intein (protein splicing domain) 0.0077
Further Details:      
 
Weak hits

Sequence:  gi|428220158|ref|YP_007104328.1|
Domain Number - Region: 109-151
Classification Level Classification E-value
Superfamily AF1531-like 0.000641
Family AF1531-like 0.012
Further Details:      
 
Domain Number - Region: 269-353
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0188
Family Anticodon-binding domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428220158|ref|YP_007104328.1|
Sequence length 439
Comment DNA polymerase III subunit alpha [Synechococcus sp. PCC 7502]
Sequence
MVKIVSCKPLRVQTVYDIGVEKDHNFILDNGLVASNCFNKSHSVAYGYVTYQTAYLKANY
PVEYMAALLSSSSGDQDKVQKYIASCNNMGIEVLPPDINESGIDFTPRNTKIMFGLAAIK
NLGEGAVHSILEAREVGGSFSSLADLCSRVDARALNKKGLEALIQTGAFDRLNSNRHQLI
SDLEVTVEWASRKAKDQASGQGSLFDMLGGEAEKVIFDETPAGIPVEDYPPQEKLRMEKE
LLGFYISDHPLKIVKSSAAVIAPINLSDMEEYVGRTITAIVLVTDIKEIVTKKGDRMAVI
QIEDLTGRAESVIFPKTYEKVRLNLQKDARLMIWGKIDRRDEQSQLILDDLQPIDSVRMV
KIHLSYEDAQESQKLYALREILREQKDPEENGKVPVIASIGESSQLVRFGNQFWVKDEIL
TVEALLKANFQAQADGLVK
Download sequence
Identical sequences K9SPS4
WP_015166852.1.58188 gi|428220158|ref|YP_007104328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]