SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428220375|ref|YP_007104545.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220375|ref|YP_007104545.1|
Domain Number 1 Region: 62-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.34e-24
Family Phosphate binding protein-like 0.062
Further Details:      
 
Weak hits

Sequence:  gi|428220375|ref|YP_007104545.1|
Domain Number - Region: 309-358
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.00419
Family Inorganic pyrophosphatase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220375|ref|YP_007104545.1|
Sequence length 450
Comment nitrate/sulfonate/bicarbonate ABC transporter substrate-binding protein [Synechococcus sp. PCC 7502]
Sequence
MSDFNLNSSRRRFLAKAGATAVGAVLLKGCTGNPPSDTPTATSPNAAPTATTTATGQKPE
VTKVKLGYIPIVEAAPLIIAKEKGFFAKYGLPDVELSKQANWGAARDNVKIGAAAGGIDG
GQWQMPMPYLISEGIITGNQKVPMYVLLQLNTQGNGIAIAGKHKGQNVGLKVDKSFFDKL
KSGGSKFKAAYTFPKANQEFWIRYWLAANGVNPDNEVELLTVPTAQTVANLKSGTMDAFS
TGDPWSYRLVRDKIGFISALTAEIWKDHPEEYLALRADWVDKNPIATKAMLKAVMEAQQW
CDNFDNRKELVDIVSVREYYNIPKDVLEQTIVGKYDMGDGRKIDDKSLAVLYWKDAKGNV
SYPYQSHDLWFLTESVRWGFLPKETLATAKDLIKKVNREDLWREAAKELGIPAADIPTST
SRGIEEFFDGTKFDPENPQAYLDGLKIKKV
Download sequence
Identical sequences K9SQJ0
WP_015167069.1.58188 gi|428220375|ref|YP_007104545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]