SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428220463|ref|YP_007104633.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220463|ref|YP_007104633.1|
Domain Number 1 Region: 179-498
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.96e-107
Family Leucine aminopeptidase, C-terminal domain 0.000000522
Further Details:      
 
Domain Number 2 Region: 1-182
Classification Level Classification E-value
Superfamily Macro domain-like 1.35e-25
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220463|ref|YP_007104633.1|
Sequence length 499
Comment leucyl aminopeptidase [Synechococcus sp. PCC 7502]
Sequence
MQIYTSVSNVGNWVGDGCAIAIFKNEPLLTPELIALDQQIFAGTLQDLITENEFKADAES
NVSSRLSVGSPIRKVLLLGLGDRNKVTLETWRKASAQAVKWAEQNKCKTLALAFPLDNSK
KEEEFATTQAIAEGIILAAHKDKRFKSDQKGNGKLENIEILGTDSDAAKAGIAQAQKICS
GVILARELVAAPANIVTPQALATEAQVIADAYTYVSLEVLEKADCEALGMGAFLGVSQAS
DLPPKFIHLTYRPQTVTKKLGIIGKGVTFDSGGLNIKAGPGSSIEMMKMDMGGAAAMLGA
AKAIAQIQPDGIEVHFISAVCENMINGNALHPGDILTASNGKTIEVNNTDAEGRLTLADA
LVFADKLGLDAIVDLATLTGAIIISLGTTMAGYWANDDELATKIETAASTAGEKFWRMPL
EESYFDKMKSVVADFKNTGSREGGSITAALFLKQFIDKTPAWAHLDIAGPVWADKDSGYT
NVGGTGYPVRTLVNLILNF
Download sequence
Identical sequences K9SQM3
WP_015167157.1.58188 gi|428220463|ref|YP_007104633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]