SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428220672|ref|YP_007104842.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220672|ref|YP_007104842.1|
Domain Number 1 Region: 1-170,267-380
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-38
Family FAD-linked reductases, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220672|ref|YP_007104842.1|
Sequence length 406
Comment geranylgeranyl reductase [Synechococcus sp. PCC 7502]
Sequence
MTLRVAVIGGGPAGSCAAETLVKAGIETYLFERKLDNAKPCGGAIPLCMVSEFDIPDRII
DRKVRKMKMISPSNVEVDIQIENEGEYIGMCRRELLDAFLRDRAKDLGAKLINGRVLDIK
IVEKGNKPYTISYSDMSDGGIEGTLKSLEVDLIVGADGFNSVVAKAIDAGDYNYAIAFQE
RIKISDDKMKYYEDLAEMYVGNDVSTDFYAWVFPKYDHVAVGTGTMKPHQRDIKKLQAGI
RTRAHNRIEGGEIIKVEAHPIPEHPRPRRVVGRVALVGDAAGYVTKSSGEGIYFAAKSGR
MCAEAIVEFSQNNTRIPTEADLKVYLKRWDKKYGATYKVLDILQRVFYNSDASREAFVEM
CADKDVQKMTFDSYLYKTVVPANPFVQLKITAKTIGSLLRGNALAP
Download sequence
Identical sequences K9SQ20
WP_015167366.1.58188 gi|428220672|ref|YP_007104842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]