SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221123|ref|YP_007105293.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428221123|ref|YP_007105293.1|
Domain Number - Region: 15-45
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0116
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221123|ref|YP_007105293.1|
Sequence length 70
Comment hypothetical protein Syn7502_01048 [Synechococcus sp. PCC 7502]
Sequence
MSEIIFPGSAVRVSNVADTYYGFEGQVQRVSDGRVAVLFEGGNWDKLVSFRPTELELVDA
TLSRNKGRKK
Download sequence
Identical sequences K9SSE7
gi|428221123|ref|YP_007105293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]