SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221139|ref|YP_007105309.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221139|ref|YP_007105309.1|
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000173
Family 7-Fe ferredoxin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221139|ref|YP_007105309.1|
Sequence length 75
Comment ferredoxin [Synechococcus sp. PCC 7502]
Sequence
MAYTIVTDICEGVAECASQCPVACIHEGGGANLKGTSWYWIDFDTCIDCGVCLVVCPVQG
AVLPEARPNLQRTPQ
Download sequence
Identical sequences K9STQ4
WP_015167833.1.58188 gi|428221139|ref|YP_007105309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]